Protein Info for CA264_07425 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 256 to 257 (2 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 300 to 325 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 335 (322 residues), 179.7 bits, see alignment E=4.5e-57

Best Hits

KEGG orthology group: None (inferred from 33% identity to psn:Pedsa_0435)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YR12 at UniProt or InterPro

Protein Sequence (379 amino acids)

>CA264_07425 AI-2E family transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MEIKLPPYFKYTVILLGLTLLILGLRTFKPILMPLAFGLLFALLLLPLTRDLESKLRFPR
PLAILSGITLVVVVLGLVAWFVSMQLVSLTSELDTIGQNVEGLITRGQDFMYNRFGIAAP
NKSEIIQNAIGNIQDLSATFLSSTISMTTGAITVLTLVPIFVFCLLYYRDHLEQFLFKFV
TKDRRGGVIHTMTDIQHVVHSYISGLMIVIVVVALLNTAGLLILGVKYAIFFGIFASILT
IIPYIGILIGASLPALFTLATTGNLLDAVLVVLVFMFVQFLEGNFITPFVVGSKVSINPF
AAIVALLIGGEIWGAAGMVLSIPVIAMMKVIFDVYPPLQPFGYLLADIEDLHPKKKGGIS
TWLSELVNGLGRGKKDIDR