Protein Info for CA264_07405 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF07721: TPR_4" amino acids 60 to 77 (18 residues), 11 bits, see alignment (E = 0.00057) PF13432: TPR_16" amino acids 96 to 157 (62 residues), 27.2 bits, see alignment E=4.2e-09 amino acids 198 to 253 (56 residues), 26.3 bits, see alignment E=7.8e-09 amino acids 299 to 330 (32 residues), 17.2 bits, see alignment (E = 5.7e-06) PF13181: TPR_8" amino acids 125 to 156 (32 residues), 23.8 bits, see alignment (E = 3e-08) amino acids 198 to 225 (28 residues), 18.3 bits, see alignment (E = 1.9e-06) amino acids 226 to 256 (31 residues), 16 bits, see alignment (E = 1e-05) amino acids 262 to 288 (27 residues), 15.5 bits, see alignment (E = 1.4e-05) amino acids 295 to 326 (32 residues), 19.9 bits, see alignment (E = 5.7e-07) PF13429: TPR_15" amino acids 157 to 254 (98 residues), 27.1 bits, see alignment E=2.4e-09 PF13174: TPR_6" amino acids 160 to 190 (31 residues), 13.6 bits, see alignment (E = 8e-05) amino acids 299 to 326 (28 residues), 18.9 bits, see alignment (E = 1.7e-06) PF14559: TPR_19" amino acids 171 to 229 (59 residues), 34 bits, see alignment E=2.7e-11 amino acids 274 to 336 (63 residues), 28.4 bits, see alignment E=1.5e-09 PF13428: TPR_14" amino acids 193 to 232 (40 residues), 25 bits, see alignment 1.9e-08 PF07719: TPR_2" amino acids 294 to 326 (33 residues), 25.1 bits, see alignment 1.1e-08 PF13176: TPR_7" amino acids 297 to 325 (29 residues), 24.2 bits, see alignment (E = 2.2e-08)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQX5 at UniProt or InterPro

Protein Sequence (359 amino acids)

>CA264_07405 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MRVYRLLLLVLSVSMVSCTLEEGDSEQMVNLQVVKDNPAAQLENLNAAIERSKRDGSLYA
RRAVVLLRRGELEQALEDADKAVRLTKNEPASLFVKAQVLRAMGKREEALPLALQAERNS
YQSTSLYVLLGDLYLQRQEHEQALQYLRKAQNLSPADEFAYYYKGRVQEATGDTAKAIQN
YKLALGQVPDFTEAQRELAALLIDKGDYTSAKPYLQRALKAAPKDAKLWYNRGLGYQAEQ
KQDSAMQAFAKAVSINDTLSGAHYRLGVYQHNLGNNEAALEHLQKAYEAFKGKPEYLGKL
ASAYERTGQYREALSAYQRLLEVEPKATYAYQSVARLKYKISKPLPDSAAVRLQEQIER