Protein Info for CA264_07395 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF05198: IF3_N" amino acids 7 to 75 (69 residues), 107.8 bits, see alignment E=2.4e-35 TIGR00168: translation initiation factor IF-3" amino acids 7 to 168 (162 residues), 188 bits, see alignment E=5.1e-60 PF00707: IF3_C" amino acids 82 to 167 (86 residues), 105.8 bits, see alignment E=8.7e-35

Best Hits

Swiss-Prot: 67% identical to IF3_PARD8: Translation initiation factor IF-3 (infC) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 75% identity to mtt:Ftrac_0509)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQX8 at UniProt or InterPro

Protein Sequence (173 amino acids)

>CA264_07395 translation initiation factor IF-3 (Pontibacter actiniarum KMM 6156, DSM 19842)
MEEPYKVNEKITAREVRVVGDNVEQGVYSTRDAQKLANEQNLDLVEISPTANPPVCRIID
YSKFKYEQKKKTREMKAKQQKVVIKEIRFGPNTDDHDFEFKLKHAKGFLESGYKIKSYVH
FVGRSIVFKERGEILLLKFAQALEDLAKVEQLPKLEGKRMFLILSPKAAPVKK