Protein Info for CA264_07380 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADP-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF16884: ADH_N_2" amino acids 4 to 110 (107 residues), 139.7 bits, see alignment E=4.9e-45 PF00107: ADH_zinc_N" amino acids 156 to 290 (135 residues), 81.7 bits, see alignment E=7.2e-27 PF13602: ADH_zinc_N_2" amino acids 189 to 327 (139 residues), 46 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 63% identical to YFMJ_BACSU: Putative NADP-dependent oxidoreductase YfmJ (yfmJ) from Bacillus subtilis (strain 168)

KEGG orthology group: K07119, (no description) (inferred from 65% identity to bay:RBAM_007690)

Predicted SEED Role

"Putative oxidoreductase YncB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQW6 at UniProt or InterPro

Protein Sequence (337 amino acids)

>CA264_07380 NADP-dependent oxidoreductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKNKTIILASRPKGVPANENFKFEEREIPALQDGEVLLKSLYVSVDPYMRGRMSDAKSYV
APYEVGEPITGGIVAEVVDSRNSKLPKGAVVLGNLPWQQYTVHSGSGLSQIQPDVAPLSY
HLGILGMPGLTAYFGLLHIGEPKPGETVVVSGAAGAVGTVVGQIAKIKGCRVVGVAGSDD
KVEYLKQELGFDEAINYKTAGDMKEAMAKACPDGVDVYFDNVGGEISDAVYLSLNKFARI
AICGQIAYYNSTTLPTGMRVEPILLKMSALMKGFIVSDYASEFGTAARELAAWVKEGKLQ
YQETITEGFDNIPQAFFGLFSGENTGKQLVKVADREA