Protein Info for CA264_07320 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: arsenical-resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 13 to 342 (330 residues), 446.2 bits, see alignment E=3.9e-138 PF01758: SBF" amino acids 58 to 254 (197 residues), 200.5 bits, see alignment E=1.1e-63

Best Hits

Swiss-Prot: 64% identical to ARSB_BACSU: Arsenite resistance protein ArsB (arsB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 73% identity to phe:Phep_3146)

MetaCyc: 64% identical to arsenite efflux transporter Acr3 (Bacillus subtilis)
TRANS-RXN0-264

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQX4 at UniProt or InterPro

Protein Sequence (360 amino acids)

>CA264_07320 arsenical-resistance protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MPSCNPTYKRQRLSFLDRYLTLWIFLAMGLGVAIGYLVPGAEGVINSFQHGTTNIPIALG
LILMMYPPLAKVRYEQLGKVFRNIRVLTVSLVLNWLVGPVLMFLLAVLFLRDYPEYMVGL
IMIGLARCIAMVIVWNELAEGDREYAAGLVAFNSIFQVVLYSFYAYLFITVLPPYFGIKG
EVVSIRMGEVAESVAIYLGIPFAAGLLSRIVLKSVKGEEWYQQRFIPAISPVTLVALLFT
IVVMFSLKGSTIVSIPFDVLLLAVPLCIYFGVMFLLSFFAGKAVGADYSQNAAISFTAAG
NNFELAIAVAIGVFGLNSGQAFVGVVGPLVEVPALILLVNVAQWLRKRFYTSKEQALVKS