Protein Info for CA264_07310 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details PF00512: HisKA" amino acids 212 to 276 (65 residues), 44.2 bits, see alignment E=1.6e-15 PF02518: HATPase_c" amino acids 329 to 401 (73 residues), 34.1 bits, see alignment E=3.3e-12

Best Hits

KEGG orthology group: None (inferred from 34% identity to chu:CHU_2731)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQZ1 at UniProt or InterPro

Protein Sequence (420 amino acids)

>CA264_07310 two-component sensor histidine kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRVLTKTSLYYVLVSLLVFAVGGTLFYLSMREEIYDEVDDQLFTDKENIISYVRQHNRLP
NVTSGISEAILVKEGHPESLVMEQLSDTLIYSSYDEEEIPFRQLTFSVQQQGKIYQYTVL
KSLMDFQDLVESTVLAMFWTFLLLLTGLVFVNYYTSKYTWRHFYDTLSKIKRYTLAQHQP
LRLQHTTTKEFQELNEVLQNMTGKIHSDYLNLKEFTENVSHEIQTPLAIVSSKVELFMQS
ENLTEEQAKLLSDMYGAINRLARLNKSLILLTRIENREFGVDEQVPLHQVLQDLLTQLQE
VITMRGLEIKVEKLEEVYLKMNSGLADVLLQNLLHNAIKHNQPGGSISILLTSEKLCVKN
TGDAPQEQPEELFSRFRVGDDTVGSLGIGLALVKKICSLYQLHPKYRYGSGVHSLCIYFT