Protein Info for CA264_07300 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: TIGR00374 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 239 to 266 (28 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 324 to 340 (17 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 17 to 331 (315 residues), 112.9 bits, see alignment E=1.1e-36 TIGR00374: TIGR00374 family protein" amino acids 27 to 343 (317 residues), 72.8 bits, see alignment E=1.7e-24

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 41% identity to mtt:Ftrac_1459)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQX0 at UniProt or InterPro

Protein Sequence (370 amino acids)

>CA264_07300 TIGR00374 family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MALTRQNLQAKFSLRNILLPVFLGLGVIGYMLYKNYEPGQLQTLVQASPFWVGMALLVLF
VRDFGYMYRIRHITEKVLSWKQSFNVIMLWEFASCALPSVVGGSTIAAYILNKEKIPLGK
SIAQVMLTAMLDNVYFVLAVPLVLLFTQGQVLPELAGLSETVRESIGIAFFVSYLMIALY
ACSMFYALFVNPKAVKRLLIRLGQLKPLRRWKEPLFRHANELLIASSHMRTKNMSYWLRA
SVSTVFVWTARYLIIGCLIAAFTHLSLHDHLVIFARNLIYKIVLFVSVTPGGAGFAEISF
PAFFGAFVGGFTTIVVLLYRLLTYYLYLVVGAVIFPRWAARVYSKEDDTPALPQNNNFRP
MPPKPQQLAV