Protein Info for CA264_07175 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 53 to 93 (41 residues), 31.3 bits, see alignment 4.1e-11 PF00529: CusB_dom_1" amino acids 114 to 338 (225 residues), 26.7 bits, see alignment E=1.3e-09 PF16576: HlyD_D23" amino acids 165 to 293 (129 residues), 70.2 bits, see alignment E=4.9e-23 PF12700: HlyD_2" amino acids 169 to 292 (124 residues), 32.4 bits, see alignment E=1.4e-11 PF13437: HlyD_3" amino acids 217 to 326 (110 residues), 66.1 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 37% identical to EMRA_ACIBT: Colistin resistance protein EmrA (emrA) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 68% identity to phe:Phep_4261)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQT9 at UniProt or InterPro

Protein Sequence (348 amino acids)

>CA264_07175 secretion protein HlyD (Pontibacter actiniarum KMM 6156, DSM 19842)
METTNKKKPNKVLIVILAAIILIGGGYGVKEYLYLSKHEDTDDAQIDADISPVVARVGGY
VDTIMFEENQHVKQGQLLVKLDERDYRIKLEQALAAQHGASAGIDVTQAQVSTTRANAST
ARSNAEAAKVKLWQAEEDFKRYANLVQDGSITQQQFDQAKAQRDAARAAYQAAQDQYRAA
QEQIKTTQSQLAVNNIGVDQRQADVDFAKLQLSYTNIEAPAGGIVSKKSIQKGQLVQPGQ
TLFSIVNDNSLYVTANFKETQLENLHEGQHVDIRVDAFPEEKIEGEIYNFSPATGAKFSL
LPPDNATGNFVKVVQRVPVKIKLKASEEVLKKLRAGMSVYVSVLTKEG