Protein Info for CA264_07130 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13432: TPR_16" amino acids 36 to 87 (52 residues), 22.5 bits, see alignment 4e-08 amino acids 106 to 136 (31 residues), 19.1 bits, see alignment (E = 4.5e-07) PF07676: PD40" amino acids 225 to 261 (37 residues), 17.8 bits, see alignment 7.8e-07 amino acids 280 to 315 (36 residues), 31.9 bits, see alignment 3e-11 amino acids 331 to 368 (38 residues), 22.3 bits, see alignment 3e-08 PF00691: OmpA" amino acids 539 to 634 (96 residues), 85.3 bits, see alignment E=9.1e-28

Best Hits

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQW4 at UniProt or InterPro

Protein Sequence (641 amino acids)

>CA264_07130 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MYKPLLTSFLLLLGIATATMAQTRLSTTSAKAERLYEKADSYVRARDFDRALEALAAAAE
KDPNFAEAYLRAAGLHKMMGNKAAAFENLEKGLKLLPFSKGQATNYFDLAEMHFDRGNYD
AAREWYETYLKTGSTNAKMVDWARHQLKTATFAQEAMQKPVQFDPVQLPNTLNRFGLQYF
PYTTADQHYFIYTARESARPEHDENIYVSQKRGEDWQPPLPISENINSPANEGAATISGD
GMTLVFTSCNRPDSQGDCDLYISFRTGSEWSKPQNMGKTVNSKAWDSQPSLSADGRTMYF
TSTRGGGIGKEDIWVTYRNDDGSWQQPQNLGMPVNSTGRDMAPSIHVSGSTLYFVSDGHV
GMGGLDIFKTNLQANRKWTEPKNLGYPLNTFADEGSLFITPDNRIGYYSRQVNSEAGTPS
IQLYQFAVPAEWRSSEMSTYAQGRVFDATNKKPLAAQVQLYDVEADSLVQQVSSDKVSGE
YTVVLTQGKQYALYVSAPQYLMNSRSFDYTSSKALSPVALDVYLDPIKAGAAVVLNNLFF
DTGKYSLEKKSKTELDKLIAFMQQNPQVKIEISGHTDDVGSDQANQVLSERRAKSVVDYL
ASNSVSRDRIRYKGYGESKPVQPNSSEENRQLNRRIEMWVL