Protein Info for CA264_07030 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 254 to 274 (21 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 4 to 270 (267 residues), 79.2 bits, see alignment E=1.1e-25 PF02719: Polysacc_synt_2" amino acids 5 to 159 (155 residues), 22 bits, see alignment E=3.3e-08 PF05368: NmrA" amino acids 5 to 116 (112 residues), 24.5 bits, see alignment E=6.9e-09 PF01370: Epimerase" amino acids 5 to 228 (224 residues), 125.8 bits, see alignment E=7.5e-40 PF16363: GDP_Man_Dehyd" amino acids 6 to 319 (314 residues), 84.9 bits, see alignment E=3.1e-27 PF01073: 3Beta_HSD" amino acids 6 to 217 (212 residues), 74.8 bits, see alignment E=2.5e-24 PF07993: NAD_binding_4" amino acids 7 to 51 (45 residues), 21.9 bits, see alignment 3.4e-08 amino acids 66 to 176 (111 residues), 39.7 bits, see alignment E=1.3e-13 PF13460: NAD_binding_10" amino acids 9 to 181 (173 residues), 53 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: None (inferred from 61% identity to phe:Phep_2197)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQS1 at UniProt or InterPro

Protein Sequence (330 amino acids)

>CA264_07030 UDP-glucose 4-epimerase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKERVLITGASGFVGYHLIEAALQAGMEVYAAVRASSEVSHLQVFDINYTSLDFQDTNAL
VKELEEKQYHYIIHAAGTTKAKHSLDYVNINAVYTKNLASAAAEADIPLKKFVFISSLAA
LGPIPYQEVAPIQEQSKAQPVTAYGKSKLLAEKYLQEIENLPLVVLRPTAVYGPREKDIF
IVLKTLNLGLEPYISNKPQWLSFVYVKDLAKAVMQALGTSIKGVSYNVSDGNSYDRYALA
TATKQILGKKAVKVHLPLGMVMLIANLLEALYASSKAMPALNREKLSELAAENWNCSIDK
IKSDLGFVPEYDLEKGLAQTLKWYKENKWL