Protein Info for CA264_07025 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: inositol-3-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF07994: NAD_binding_5" amino acids 12 to 418 (407 residues), 354.1 bits, see alignment E=8.7e-110 PF01658: Inos-1-P_synth" amino acids 246 to 358 (113 residues), 112.4 bits, see alignment E=1.2e-36

Best Hits

KEGG orthology group: K01858, myo-inositol-1-phosphate synthase [EC: 5.5.1.4] (inferred from 77% identity to cpi:Cpin_2400)

Predicted SEED Role

"Inositol-1-phosphate synthase (EC 5.5.1.4)" in subsystem Di-Inositol-Phosphate biosynthesis (EC 5.5.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXY7 at UniProt or InterPro

Protein Sequence (442 amino acids)

>CA264_07025 inositol-3-phosphate synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEYNVKNAEGRLGILLPGLGAVATTFIAGVEAIRKGMSQPIGSLSQMGNIRLGKRTENRN
PLIKDFVPLANLNDIVFGGWDVYEDNVYEAAVNAKVLEPGLLHALKPELEAIQPMKAVFD
KAYARNLDGTNVKEAATKYELAEALMDDMRSFKEENGCDRLVIVWCGSTEIYAEISDVHE
TIAAFEEGLRNNDPRIAPSMIYAYAAVKMGVPFANGAPNLTVDIPAIVELAKQNGVAISG
KDFKTGQTLMKTILAPGLQARALGIKGWFSSNILGNRDGLVLDDPENFKTKEVSKLGVLE
DILHPDDNPELYGDIYHKIRINYYPPHGDNKESWDNIDIFGWLGYQMQIKINFLCRDSIL
AAPIVLDLALFTDLAQRAGMSGIQEWLSFYYKSPQTAEGLRPEHDIFKQLIKLQNTLRHM
MGEDLITHLGLDYYEDFVEEER