Protein Info for CA264_07005 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: CDP-diacylglycerol--inositol 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01066: CDP-OH_P_transf
  • amino acids 31 to 170 (140 residues), 61.6 bits, E=5.9e-21

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 63% identity to ppn:Palpr_2421)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• cardiolipin biosynthesis I (2/3 steps found)
• cardiolipin biosynthesis II (2/3 steps found)
• cardiolipin biosynthesis III (2/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (4/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

See A0A1X9YQS3 at UniProt or InterPro

Protein Sequence (239 amino acids)

>CA264_07005 CDP-diacylglycerol--inositol 3-phosphatidyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDKNSLRDALQQGIYKVINPVVRFLIKVGFTPNAVTTTGLILNIGVAAIFIVGGEVSNRG
ELEYVGWAGGLVLFAGLFDMLDGQVARLGNMGSTFGAMYDSVLDRYSEMIMFMGICYYLI
AHHYLLSSLFAFIALIGSMMVSYTRARAEGLGVECKGGLMQRPERVVLIGLSAIACGITY
SFVGADYKVYVEGVPFHVFETMSVFTLPITVMAVLTNITAVNRLMDAKKAMQQKEMKTA