Protein Info for CA264_06990 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: PA-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 43 to 56 (14 residues), see Phobius details amino acids 59 to 60 (2 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details PF14378: PAP2_3" amino acids 117 to 292 (176 residues), 92.8 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: None (inferred from 62% identity to sli:Slin_1527)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQP8 at UniProt or InterPro

Protein Sequence (316 amino acids)

>CA264_06990 PA-phosphatase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSVTATAAGEKKGITRKAVLVLAALSVGYLLLSYLLVGFKTDQLVLVGLINLLYFLRPIT
RKFITGFSIFVVFWILYDYMKAFPNYWFNPVHIESLYMAEKAWFGVESGGVILTPNEFWL
QHSHPFLDVMSGAFYLTWVPVPIGFAFFWFFRNRRQFVHFLLTFLLVNLLGFVVYYLYPA
APPWYVQLHGFDFIAKTPGNTAGLSRFDGFFGITIFNALYAKGSNVFAAMPSLHSAYPLI
VLYYALRNNLSIAAKVVFGIITVGIWFAAVYTSHHYVLDVLAGITCATTGILLFNWLVKQ
DTALSRAIERLVAAVR