Protein Info for CA264_06950 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00255: GSHPx
  • amino acids 41 to 147 (107 residues), 107.9 bits, E=1e-35

Best Hits

Swiss-Prot: 33% identical to GPX4_CITSI: Probable phospholipid hydroperoxide glutathione peroxidase (CSA) from Citrus sinensis

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 42% identity to hhy:Halhy_2443)

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (2/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.9

Use Curated BLAST to search for 1.11.1.9

Sequence Analysis Tools

See A0A1X9YQR2 at UniProt or InterPro

Protein Sequence (196 amino acids)

>CA264_06950 glutathione peroxidase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTIKQLILKKLYPLIMRLSKSSDAKGKVLSNKQGAAPKVPFYQLKVLQNNGELLDFSQLK
DKKVLLVNTASNCGYTGQYEELQQLHEELQDKVVVVGFPANDFREQEKSNDTDIAQFCQV
NFGVTFPLVKKSSVVKGQEQNPVYQWLTQAEQNGWNTHQPDWNFSKYLVDEKGALTHYFG
PAVSPLSPDVMRALQS