Protein Info for CA264_06930 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acetolactate synthase, large subunit, biosynthetic type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02776: TPP_enzyme_N
  • amino acids 19 to 135 (117 residues), 126 bits, E=1e-40
• TIGR00118: acetolactate synthase, large subunit, biosynthetic type
  • amino acids 19 to 574 (556 residues), 704.2 bits, E=5.8e-216
• PF00205: TPP_enzyme_M
  • amino acids 212 to 343 (132 residues), 156 bits, E=7.1e-50
• PF02775: TPP_enzyme_C
  • amino acids 406 to 553 (148 residues), 168.3 bits, E=1.6e-53

Best Hits

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 76% identity to psn:Pedsa_2350)

Predicted SEED Role

"Acetolactate synthase large subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of L-isoleucine biosynthesis I (11/13 steps found)
• L-valine biosynthesis (4/4 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• superpathway of 2,3-butanediol biosynthesis (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis II (5/8 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis IV (3/6 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)
• superpathway of L-threonine metabolism (10/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See A0A1X9YQP0 at UniProt or InterPro

Protein Sequence (577 amino acids)

>CA264_06930 acetolactate synthase, large subunit, biosynthetic type (Pontibacter actiniarum KMM 6156, DSM 19842)
MLTKEKQATALPKQATSISGAEAVILALLEEKVDTVFGYPGGAIMPVYDALFDYTDRLNH
VLVRHEQGGIHAGQGYARASGKVGVVFATSGPGATNLVTGLADAQIDSTPLVCISGQVYA
HLLGTDAFQEIDILNITTPVTKWNYQVANAEEIPDVLAKAFYIAKSGRPGPVLIDITKNA
QLQQFEFSGYQPCQHIRSYRPKPVVRQEYILQAAELINQAQKPFILWGQGVMLGAAEKEF
RAFVEKSGIPAAWTIMGAGALPSRHPQNVGMLGMHGNYGPNVLTNECDVLIAIGMRFDDR
VTGRLDKYARQARIIHLDIDPTEIGKNVPVTVPVWGDCKETLPLLTELVEPRQHTAWLQQ
FRRYNEQEIEAVIQEELFPTSEEMTMGEVVQQLNELTGGDAIVVSDVGQHQMVACRYASL
NHTRSNITSGGLGTMGFALPAAIGAKYGAPERTVVAVIGDGGFQMTLQELGTIMQSGADV
KLLILNNRFLGMVRQWQELFHERRYSFVDIASPDFVKVADGYGISGKSVSKREELRGALQ
QMLSHQGSYLLEVMVTKENNVFPMVPQGCSVSEIRLS