Protein Info for CA264_06925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acetolactate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF01842: ACT" amino acids 14 to 76 (63 residues), 28.2 bits, see alignment E=1.3e-10 TIGR00119: acetolactate synthase, small subunit" amino acids 14 to 166 (153 residues), 84 bits, see alignment E=5.5e-28 PF10369: ALS_ss_C" amino acids 93 to 166 (74 residues), 66.3 bits, see alignment E=2.2e-22

Best Hits

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 75% identity to phe:Phep_3420)

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQP9 at UniProt or InterPro

Protein Sequence (202 amino acids)

>CA264_06925 acetolactate synthase small subunit (Pontibacter actiniarum KMM 6156, DSM 19842)
MRNENHTQKEEFNITVYTENHIGLLTRIAIIFSRRKINVESLNTSPSEVEGIHRFSIVMT
ETAETVRKIAGQIEKQVGVLKVYFNTNQDVVWQEMALYKVPTDVIAERAVVERLLRENGA
RAVVIRKDYTVFETTGHREETDNLLRVLEPYGLIEFVRSARIAIIKDSEGFHRKLQEFEQ
SEPHDEVVENEYLSSREKVFTM