Protein Info for CA264_06925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acetolactate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01842: ACT
  • amino acids 14 to 76 (63 residues), 28.2 bits, E=1.3e-10
• TIGR00119: acetolactate synthase, small subunit
  • amino acids 14 to 166 (153 residues), 84 bits, E=5.5e-28
• PF10369: ALS_ss_C
  • amino acids 93 to 166 (74 residues), 66.3 bits, E=2.2e-22

Best Hits

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 75% identity to phe:Phep_3420)

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of L-isoleucine biosynthesis I (11/13 steps found)
• L-valine biosynthesis (4/4 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• superpathway of 2,3-butanediol biosynthesis (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis II (5/8 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis IV (3/6 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)
• superpathway of L-threonine metabolism (10/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See A0A1X9YQP9 at UniProt or InterPro

Protein Sequence (202 amino acids)

>CA264_06925 acetolactate synthase small subunit (Pontibacter actiniarum KMM 6156, DSM 19842)
MRNENHTQKEEFNITVYTENHIGLLTRIAIIFSRRKINVESLNTSPSEVEGIHRFSIVMT
ETAETVRKIAGQIEKQVGVLKVYFNTNQDVVWQEMALYKVPTDVIAERAVVERLLRENGA
RAVVIRKDYTVFETTGHREETDNLLRVLEPYGLIEFVRSARIAIIKDSEGFHRKLQEFEQ
SEPHDEVVENEYLSSREKVFTM