Protein Info for CA264_06800 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 285 to 302 (18 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 372 to 390 (19 residues), see Phobius details amino acids 396 to 419 (24 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQM9 at UniProt or InterPro

Protein Sequence (435 amino acids)

>CA264_06800 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSTATVSNSPSKWVVLPHFAFAALSFMALSVLLLFSTDAFGGHYFHPKLLTLTHVAVLGW
ATMLIFGALYQLLPVVLECRLYSEKLAVYTCGLLSSGTISLAYSFWYFQLGWTMHLAACL
LLIAFLLFNINVIQTARKAPKWTIEADFIVTSAVWLLVTGLVGVLMALNFTYPFLPQEHV
HYLKLHAHIGMAGWFLLLIIGVGAKLIPMFLLAHPQGTRKLNWAYNLINGGLLLFIVDHM
LLHTGWLPLYAGLVAAGLLLFLSYLQEARKTMQRKEVDLGMQQTFVALALLLLPLVLVFV
VSSDLKLPQGLQLSLYLVYGISVFLGFVTALILGQTFKTLPFIVWMHAYEDHVGKYKTPL
PKDLYSHTLLRWQNISYLAGFVMLLAGVLLGQRQLILAGSIVFSIAASLYTANVFQLLLH
RAHDLKPFTYGSANT