Protein Info for CA264_06615 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: iron/manganese transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 443 to 464 (22 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 29 to 400 (372 residues), 402.8 bits, see alignment E=1e-124 PF01566: Nramp" amino acids 51 to 406 (356 residues), 459.6 bits, see alignment E=7.2e-142 PF00582: Usp" amino acids 495 to 627 (133 residues), 71.7 bits, see alignment E=9.2e-24

Best Hits

KEGG orthology group: K03322, manganese transport protein (inferred from 64% identity to cao:Celal_1775)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQK2 at UniProt or InterPro

Protein Sequence (627 amino acids)

>CA264_06615 iron/manganese transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MLEPGVHTGKSLEEVHSSIDTTTPTGVWRRLLAFLGPAYLVSVGYMDPGNWATDIAGGSQ
FGYKLVWVLLMSNLMAILLQSLSARLGVVRGKDLAQASRESYPPYINIPLYVLAEIAIAA
CDLAEVLGMAIGLQLLFGMPLLWGVSLTVLDTFLLLFLINKGMRKMEAFVLALVTIIGGA
FIMEMFFAKPDVSELVTGFIPSIPSSDALYIAIGIIGATVMPHNLYLHSSLVQSRKIDRS
PQGIWRAIKYNFIDSAVALNLALFVNAAILILAAAAFYTNGIHHVTEIQDAHEFLAPLLG
TKWAPILFAVALIAAGQSSTLTGTLAGQIVMEGYLNLRIQPWLRRMITRLLAVGPALFVI
IYYGEDQTGELLVLSQVVLSLQLGFAVIPLIHFVSNKDKMGEFAIGAWMKTGAWLIASVI
VILNAKLVLDQIVEWLHEAENPLLIWVLVVPVAVACCLLLLYITLQPFVTGATAHHRPAR
HQQPVSYQPEAQPAYKRIAVTLDFSDVDNTVLTNAVAIGTPAAEYLLIHIVETAGAFVLG
QDIKDMETSSDWDNLQRYADDLRARGYHVRVQLGFGNPKQRIPKIVHNFEADLLVMGSHG
HKMVKDLILGTTIDAVRHAVKVPMLII