Protein Info for CA264_06605 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 46% identical to FABH_YERE8: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 64% identity to chu:CHU_1896)

MetaCyc: 39% identical to anthraniloyl-CoA malonyltransferase monomer (Pseudomonas aeruginosa PAO1)
RXN-17710 [EC: 2.3.1.262]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
fatty acid biosynthesis initiation (type II) (3/3 steps found)
superpathway of fatty acid biosynthesis initiation (4/5 steps found)
4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
streptorubin B biosynthesis (20/34 steps found)
superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)

KEGG Metabolic Maps

Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQJ1 at UniProt or InterPro

Protein Sequence (332 amino acids)

>CA264_06605 ketoacyl-ACP synthase III (Pontibacter actiniarum KMM 6156, DSM 19842)
MRNSRIAGVGHYVPDNVVTNKDLEKIMDTSDEWIRERTGIVERRYFQEGVDTTANMGAAA
ARKAIQMAGLEATDIDLIVFATLSPDYLFPGSGVLLQRELGLKEIPALDVRNQCSGFIYA
LSVGDQFIKTGMYNNVLVVGAEIHSTGLDFSTRGRGVSVIFGDGAGAVVLTPSESNDRGI
LSTHLHSDGEFAEELAVTAPNSNKKERLTHEMIDDGSVYPYMNGNMVFKHAVTRFPEVIE
EALNKNGYKAEDIDLLVPHQANLRITSYIQQKMQLPAEKVMSNIHKYGNTTAASVPIALS
EAYEEGRVKEGDLVCLAAFGSGFTWASALIRW