Protein Info for CA264_06590 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 3-hydroxybutyryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01210: NAD_Gly3P_dh_N
  • amino acids 3 to 165 (163 residues), 31.9 bits, E=2.5e-11
• PF02737: 3HCDH_N
  • amino acids 3 to 182 (180 residues), 229.6 bits, E=5.3e-72
• PF03446: NAD_binding_2
  • amino acids 3 to 86 (84 residues), 24.1 bits, E=6.8e-09
• PF00725: 3HCDH
  • amino acids 185 to 281 (97 residues), 117 bits, E=9e-38

Best Hits

Swiss-Prot: 56% identical to HBD_THETC: 3-hydroxybutyryl-CoA dehydrogenase (hbd) from Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814)

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 77% identity to fte:Fluta_2801)

MetaCyc: 54% identical to 3-hydroxybutyryl-CoA dehydrogenase subunit (Clostridium beijerinckii)
3-hydroxyacyl-CoA dehydrogenase. [EC: 1.1.1.35]; 1.1.1.35 [EC: 1.1.1.35]

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Polyhydroxybutyrate metabolism (EC 1.1.1.157)

MetaCyc Pathways

• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• pyruvate fermentation to butanol II (engineered) (5/6 steps found)
• adipate biosynthesis (4/5 steps found)
• adipate degradation (4/5 steps found)
• fatty acid salvage (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• phenylacetate degradation I (aerobic) (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to butanol I (5/8 steps found)
• L-tryptophan degradation III (eukaryotic) (10/15 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• valproate β-oxidation (5/9 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (2/5 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• fatty acid β-oxidation I (generic) (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (8/14 steps found)
• oleate β-oxidation (23/35 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (4/10 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• 3-phenylpropanoate degradation (3/10 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (2/22 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (8/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (4/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Bile acid biosynthesis
• Biosynthesis of plant hormones
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Lysine degradation
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157, 1.1.1.35

Use Curated BLAST to search for 1.1.1.157 or 1.1.1.35

Sequence Analysis Tools

See A0A1X9YQI8 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CA264_06590 3-hydroxybutyryl-CoA dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKVAVIGSGTMGNGIAHVFAQNGFPVSLIDISEEALQKALGTISKNLDRIIAKGNLTEE
QKQQTLSNVTTFTNMQEGVKDADLVVEAATENVDLKLKIFRDLDSYTKPEAILASNTSSI
SITKIASVTNRPDKVIGMHFMNPVPVMKLVEVIRGYSTTDEVTQQIMDLSKQLGKVPAEA
NDYPGFVANRILMPMINEAIYSLFEGVAGVEEIDTIMKLGMAHPMGPLQLADFIGLDVCL
SILNVLHDGFGNPKYAPCPLLVNMVQAGHKGVKSGQGFYSWTHGTKELVVAPGFKK