Protein Info for CA264_06525 in Pontibacter actiniarum KMM 6156, DSM 19842
Annotation: monofunctional biosynthetic peptidoglycan transglycosylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 50% identical to MTGA_PSE14: Biosynthetic peptidoglycan transglycosylase (mtgA) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
KEGG orthology group: K03814, monofunctional biosynthetic peptidoglycan transglycosylase [EC: 2.4.1.-] (inferred from 52% identity to dfe:Dfer_2412)Predicted SEED Role
"Monofunctional biosynthetic peptidoglycan transglycosylase (EC 2.4.2.-)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.2.-)
KEGG Metabolic Maps
- Anthocyanin biosynthesis
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Carotenoid biosynthesis - General
- Flavone and flavonol biosynthesis
- Flavonoid biosynthesis
- Fructose and mannose metabolism
- Glycerolipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Glycosphingolipid biosynthesis - globo series
- Glycosphingolipid biosynthesis - lacto and neolacto series
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- High-mannose type N-glycan biosynthesis
- Keratan sulfate biosynthesis
- Lipopolysaccharide biosynthesis
- N-Glycan biosynthesis
- O-Glycan biosynthesis
- O-Mannosyl glycan biosynthesis
- Peptidoglycan biosynthesis
- Purine metabolism
- Sphingolipid metabolism
- Zeatin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.2.-
Use Curated BLAST to search for 2.4.1.- or 2.4.2.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9YQK1 at UniProt or InterPro
Protein Sequence (244 amino acids)
>CA264_06525 monofunctional biosynthetic peptidoglycan transglycosylase (Pontibacter actiniarum KMM 6156, DSM 19842) MAKKRLGLRQVKLLFVKLVLSLFLISVVWVLLYRWVAPPATLHMLQRRAEAGAAEKEEPG IKYKFVPLEEMSPQLPLAVVASEDQLFLQHHGFDFDAIWDAFQRNQKGGNIRGGSTISQQ VAKNVFLWHGRSYFRKAVEAYFTMLIEVLWGKERIMEVYLNIAEMGDGVFGVEAAAQKYF DKPASDVGRQQAALLAAVLPNPIKYSAKNPSGYVRTRRGRIARAMGRLGGTTYIKEILPE TDEK