Protein Info for CA264_06515 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: transcription elongation factor GreAB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF01272: GreA_GreB" amino acids 92 to 171 (80 residues), 68.9 bits, see alignment E=1.5e-23

Best Hits

Swiss-Prot: 31% identical to GREA_LEGPC: Transcription elongation factor GreA (greA) from Legionella pneumophila (strain Corby)

KEGG orthology group: K04760, transcription elongation factor GreB (inferred from 51% identity to gfo:GFO_1553)

Predicted SEED Role

"Transcription elongation factor GreB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQH0 at UniProt or InterPro

Protein Sequence (172 amino acids)

>CA264_06515 transcription elongation factor GreAB (Pontibacter actiniarum KMM 6156, DSM 19842)
MSRAFVKEDDAGQPPIIPPRAALPAGVTNYVTPQGLEQLRQELSGLEAARAKTEANHEDE
ANRTRELTVMNGRISALADRIASAKVVDVRQQPNDEVRFGATVTLRTQSGGKSGAHRTFT
IVGVDEASIAEGKIAFVAPIAKAVVGRAVGEAVTLRLGRSEEVVEVVSIKYL