Protein Info for CA264_06465 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00336: orotate phosphoribosyltransferase
  • amino acids 13 to 179 (167 residues), 144.8 bits, E=1.1e-46
• PF00156: Pribosyltran
  • amino acids 69 to 155 (87 residues), 41.1 bits, E=5.7e-15

Best Hits

Swiss-Prot: 59% identical to PYRE_CYTH3: Orotate phosphoribosyltransferase (pyrE) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 64% identity to dfe:Dfer_0239)

MetaCyc: 53% identical to orotate phosphoribosyltransferase (Bacillus subtilis subtilis 168)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

See A0A1X9YQI3 at UniProt or InterPro

Protein Sequence (212 amino acids)

>CA264_06465 orotate phosphoribosyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDSTTTAHQVASFLLETEAVKLSPEQPFKWSSGWNSPIYCDNRVTLSFPYIRSFIKQQLA
ELVKQQYPEVEAIAGVATAGIAQGALVADLLEMPFLYVRPEPKKHGMGNQIEGRLLEGQK
VVLVEDLISTGGSSLKAAEAVKAAGAEVVGMVAIFTYGFAVADENFEKAGIPLHVLSNYN
ALLEAAAEQGYIQESAMATLAEWRQSPGTWGV