Protein Info for CA264_06405 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: VWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details PF00092: VWA" amino acids 111 to 299 (189 residues), 91.4 bits, see alignment E=8.3e-30 PF13519: VWA_2" amino acids 112 to 220 (109 residues), 78 bits, see alignment E=8.2e-26

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 53% identity to mtt:Ftrac_0401)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQF1 at UniProt or InterPro

Protein Sequence (349 amino acids)

>CA264_06405 VWA domain-containing protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MLEINNELWDWLSLEWFSYSTLRAFDWTYPLVLYALPAVPLLFLLKSVLRRNSRVKLDMA
LFAGRTRWQWSSLLRFVPRVVYMLFVMLVLVALARPQRVNEQVELSSAGIDIVLVLDVSG
SMELQDFKPNRLEAAKDVALNFLDGRVQDRIGMVVFAGDAYSLAPLTTDYALLRESINSI
GFKMIPNDGTAIGSALAVAINRMRDSEAKSKVIILISDGENTAGNLDPELAAQLAYAYDI
KLYTIGIGKDGMVPYLDEDGKTIFVETQMDESSLRQIARIGAGKFFRADSKDALQQVFRN
INKMEKTEVLEKRFRDTQDYYQVYLKWALLLLIIWMLLKNTFLSNVLED