Protein Info for CA264_06370 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 352 to 378 (27 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 19 to 419 (401 residues), 293.5 bits, see alignment E=1.2e-91 PF01554: MatE" amino acids 19 to 178 (160 residues), 97.5 bits, see alignment E=7.1e-32 amino acids 245 to 405 (161 residues), 107.7 bits, see alignment E=4.9e-35 PF14667: Polysacc_synt_C" amino acids 132 to 251 (120 residues), 34.2 bits, see alignment E=2.7e-12

Best Hits

Swiss-Prot: 34% identical to NORM_BRUSU: Probable multidrug resistance protein NorM (norM) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 49% identity to psn:Pedsa_0203)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQF7 at UniProt or InterPro

Protein Sequence (447 amino acids)

>CA264_06370 MATE family efflux transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MISTEYKEHFSKNFTLAYPVVLSQLGHILVSVFDSLMVGQTGTLPLAAASLGNSIFTITL
VFGLGVSYSITPLIAAADGRHNYTRISLLLLNGLVSNVLLGILLFIVGYFLSPYITVLDQ
PANVVELAVPYINVLFLSMVPLMVFQAFRQFAEGLSLTKQAMYISIVANALNIVLNYILI
FGKLGFEPMGLLGAGWATLISRVVMALAMAAWVLYAKRFAVFRRFLRLRHLSFIHMYRIY
KLGLPISGQMIFEMGAFSFSAIMIGWLGARELAAHQIAINIASVTYMMASGIAAAATIRV
GNQKGLGNFDAMRMAGFSNIAMGVVFMIGSGLLMVLFKNYIPMLYIDDPAVIQLASGLLV
IAALFQISDGIQVVGLGALRGLEDVRIPSLISLVAYWVIGLPVGYFLCFKAGFGVDGIWM
GLLVGLSVAAVLLTLRFKMLSNRLIIR