Protein Info for CA264_06355 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ergothioneine biosynthesis protein EgtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 14 to 421 (408 residues), 541.1 bits, see alignment E=1.1e-166 PF12867: DinB_2" amino acids 17 to 150 (134 residues), 32.7 bits, see alignment E=1e-11 PF03781: FGE-sulfatase" amino acids 183 to 318 (136 residues), 91.3 bits, see alignment E=8.6e-30 amino acids 339 to 421 (83 residues), 37.9 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 53% identity to hhy:Halhy_2586)

Predicted SEED Role

"FIG00490156: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQG7 at UniProt or InterPro

Protein Sequence (423 amino acids)

>CA264_06355 ergothioneine biosynthesis protein EgtB (Pontibacter actiniarum KMM 6156, DSM 19842)
MSTLTTPRTHQTLTRYQDIRRRTETICAPLEPEDTVVQPIVDVSPPKWHMAHTSWFFETF
ILSPHLPGYQAFHPRYSFLFNSYYNSVGSRVQRDQRSTLTRPPLRDIYTYRQHVDAHMEQ
LFQQLPEQELTELLPVLELGLQHEQQHQELLITDIKYILSTNPLLPAFKPRPAPKQATEK
TAARFLEVPGGTYKIGFTGEGFCFDNELGVHEVLVEDFEIMNRLVTNGEYLEFMQDGGYS
DFRHWLDEGFALVKNDHLEAPLYWVKQDNTWHRFTMHGLEEVDMNEPVCHLSFYEADAYA
NWAGKRLLTEFEWEAAAQVYPPQSGNFVESELLEPTAADPAATGMQQLYGNLWEWTYSAY
HPYPGFTKAPGAIGEYNGKFMLNQMVLRGGSCATPESHIRTTYRNFFHPDKRWQYNGIRL
ANK