Protein Info for CA264_06345 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 158 to 184 (27 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 382 to 407 (26 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 74 to 430 (357 residues), 278.2 bits, see alignment E=1e-86 PF00571: CBS" amino acids 470 to 517 (48 residues), 18.1 bits, see alignment 2.8e-07 amino acids 529 to 580 (52 residues), 25.9 bits, see alignment 1e-09

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 50% identity to fjo:Fjoh_4507)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQE7 at UniProt or InterPro

Protein Sequence (593 amino acids)

>CA264_06345 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MPHYKKTKIPLLWLRRHTSDREFMLISSVLVGLTAGMAAVILKTLVHYIHVLLAYGNRLL
DQPYWLVVFPIIGILLTVFVVRVAFNGSIGRGTAGVLFSISQKSSMVERHKMYSHVVTSA
FTAGFGGSAGLESPIVVTGSAIGSNYGRDYHLNYRDRTLLLAAGAAAGIAAVFNAPIAGV
LFAIEVLLTDISISAFIPLIISAVVGALCSKLILQEEILFNIGQREFFAASHLPFYVLLG
VLCGMMSVYYTRMALRVEELFEEYQSKVYSRAIVGGILLGLLIMLFPPLFGEGYDSIRLL
EGNNAQEMLQNSWLAFFGTNEWLVLCFVGALALVKVFAATITIASGGNGGNFAPSMFVGA
STGFFFSRLVNLLSFNNLPVSSFAMVGMAGILSGVMHAPLTAVFLIAEITGGYTLMIPLM
IVAATSYAMVKYFEPYSLDTKKLAQKGQLLTHNKDRTILRIMKIQHLIETEFQPVSPEAT
LGELVEVIAHSRRNLFPVVTADRKLDGIILLENVREIMFKTEKYDLVKVRELMVKPPAIV
QYDDSMADVMKKFDESGAWNLPVLRNETYQGFVSKSSIFTKYRKLLIKTTNVA