Protein Info for CA264_06335 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: Na+/H+ antiporter subunit G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 17 to 104 (88 residues), 79.9 bits, see alignment E=7.2e-27 PF03334: PhaG_MnhG_YufB" amino acids 18 to 96 (79 residues), 90.9 bits, see alignment E=2.5e-30

Best Hits

KEGG orthology group: K05571, multicomponent Na+:H+ antiporter subunit G (inferred from 36% identity to gfo:GFO_3559)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXX7 at UniProt or InterPro

Protein Sequence (147 amino acids)

>CA264_06335 Na+/H+ antiporter subunit G (Pontibacter actiniarum KMM 6156, DSM 19842)
MEASIDWNMVREVVSCVLILAGVGFMLTSTIGLLRFPDFYIRMSAITKGATLGVGLILLG
MGIYFNQPGILLKVLAVIVFTFMTAPVAAHVIGRTAVQNRIPFWNKTNTKEFEQYLEKEH
LEQLVSHDRYKDDTPKVRKYGDADGSE