Protein Info for CA264_06325 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details PF01899: MNHE" amino acids 13 to 162 (150 residues), 123.8 bits, see alignment E=2.5e-40

Best Hits

Swiss-Prot: 33% identical to MRPE_BACSU: Na(+)/H(+) antiporter subunit E (mrpE) from Bacillus subtilis (strain 168)

KEGG orthology group: K05569, multicomponent Na+:H+ antiporter subunit E (inferred from 55% identity to paa:Paes_0098)

Predicted SEED Role

"Na(+) H(+) antiporter subunit E" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQE8 at UniProt or InterPro

Protein Sequence (165 amino acids)

>CA264_06325 cation:proton antiporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MRLFLFHSVLAMVAVYLYFRHVETVVPYSAISASTFFAALFFLLWLTSFFYSRTYFRKLP
KFFSFLLFFFKELLVANLKIAYDIITPHYYMRPSVIALPLKARSDLEITILANIISLTPG
TLSIDVSKDRKMLYVHALYVKHNDLEKLKLHIKNGFERRLLELTA