Protein Info for CA264_06320 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: Na+/H+ antiporter subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 71 to 97 (27 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 208 to 233 (26 residues), see Phobius details amino acids 242 to 268 (27 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details amino acids 458 to 478 (21 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 129 to 421 (293 residues), 192.2 bits, see alignment E=6.2e-61

Best Hits

KEGG orthology group: K05568, multicomponent Na+:H+ antiporter subunit D (inferred from 50% identity to pbs:Plabr_3038)

Predicted SEED Role

"Na(+) H(+) antiporter subunit D" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQD5 at UniProt or InterPro

Protein Sequence (505 amino acids)

>CA264_06320 Na+/H+ antiporter subunit D (Pontibacter actiniarum KMM 6156, DSM 19842)
MTSHAILLLPLLIPLYGAVLCLVLWQKERWQALVAGLTQLGWLAAAVLLLQRVLEQEVLA
TQIGNWPAPFGITLVADVFSVLMIATGAVIGLAVFLFSLQGLDKTRKRYGYYPLLLLLQM
GVSGVCLTGDLFNLYVWFEVLLICCFALLGLGGTKAQLEGTLKYVTINFLASGLLLTGTG
IVYSLFGALNLAELALLVRQPNHPNLPLLSMASLFFLTGFGIKSAIFPLFFWLPASYHAP
PIAISAFIAGLISKVGVYTLIRLFTLVFVSNLSFMLPLLAVLSGLTMVVGVVGAAAQNDF
RKILSFHIISQIGYMLMGLAVYTPLALAGSIFFIVHNILVKTNLFLVSGVVAQRHRTFSL
KKLGGLYLRQPVLALLFLLSALSLAGTPPLSGFWGKLMLAKAGFEAGSYTLVATSLCVSL
VTLFSMTKIWTEVFWKPKPVIPVGAVAETAEDRLRNQYLYLPVALLLVFILFIGVYAGPL
VRLAEQASQGLLHIEKYTQTVLSNN