Protein Info for CA264_06305 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: pH homeostasis protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 769 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 108 to 135 (28 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 296 to 319 (24 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 444 to 466 (23 residues), see Phobius details amino acids 488 to 511 (24 residues), see Phobius details amino acids 560 to 579 (20 residues), see Phobius details amino acids 599 to 617 (19 residues), see Phobius details amino acids 624 to 642 (19 residues), see Phobius details amino acids 649 to 673 (25 residues), see Phobius details amino acids 682 to 702 (21 residues), see Phobius details amino acids 742 to 761 (20 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 63 to 108 (46 residues), 46.4 bits, see alignment 6.1e-16 PF00361: Proton_antipo_M" amino acids 124 to 410 (287 residues), 197.9 bits, see alignment E=4.5e-62 PF13244: MbhD" amino acids 606 to 670 (65 residues), 64.9 bits, see alignment E=1.2e-21 PF20501: MbhE" amino acids 683 to 760 (78 residues), 77.2 bits, see alignment E=1.7e-25

Best Hits

Predicted SEED Role

"Na(+) H(+) antiporter subunit A" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQC9 at UniProt or InterPro

Protein Sequence (769 amino acids)

>CA264_06305 pH homeostasis protein A (Pontibacter actiniarum KMM 6156, DSM 19842)
MLFAILFGFIADACAPLLRRLLGRYVFVPMAGLPLLLFLYFCYLAPEVVAGATVTAQYAW
VPELGVSLQFRLDGLSLLFALLITFFGTLIMLYASAYLEDDPLLGRFYLYLTLFMTAMLG
LVLSDNIFCLFLFWELTSVSSYLLIGYKQAKKEARVAAWQALLVTGAGGLALLAGLLLLR
IAGGGAATFSELAALQGQVQQHALYLPALLLILLACFTKSAQFPFHFWLPNAMAAPTPVS
AYLHSATMVKAGIYLLARLSPVLSGSEVWHVTLMSMGGITAVMGALLALQHTDLKAILAY
TTISALGLLVTMLGIGTALATKAMLVFLVAHALYKGTLFLVAGAVDHSTGTREVPQLQQL
APSMKFSAWAATLAALSMAGIIPFVGFVGKELLYEASLPSLVLLGVSMVTGLVFVAVALQ
LSYGIFWQKAASPTPLLHEATPGLFLPPLALGLTGLLAGVFAGPVLSPLLESGARQILQA
RQVELHLALWHGLTPVLELSLLTVLLGFLLYRYLPAARRSATSTARLYRYGPDALYHRAF
DGFLRFSKAFTGWLQNGYLRSYIINIVFFFCSLLLFVLWRDSPPVNLVERAHLLQQIRLY
ELVLLVLMVAALVFLLGTRSRLTSIVVMGLVGYSAALFYIFFGAPDVAATQLLIETLTVV
IFVLLLHRLPAFIYLSHQFNKYKFIAISVFFGSLMTYVMLLVQQHTVESELKQYFGKASY
LEAHGRNIVNVILVDFRGLDTLGEISVLAVAALGIFALLRLNPEKGGKR