Protein Info for CA264_06280 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium:solute symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details amino acids 446 to 466 (21 residues), see Phobius details amino acids 535 to 553 (19 residues), see Phobius details PF00474: SSF" amino acids 33 to 454 (422 residues), 168.7 bits, see alignment E=1e-53

Best Hits

Predicted SEED Role

"sodium-solute symporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQB2 at UniProt or InterPro

Protein Sequence (579 amino acids)

>CA264_06280 sodium:solute symporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MHYIDLSIFVLYMLAMLGVGFYFLKKNEGAEDYYVGGRSMSSGHIGLSVVATDVGGGFSI
GLGGLGFAMGLSGSWMLFTGLLGAWLAAVFLIPKVKDNPAFASFLTFPQLFGYYFNARVA
LLAGVISAIGYTGFTSSQILAGAKLASGTFVGLDLNTALLIMGVIAVVYTVMGGLKAVIY
TDTVQWAVLMGGLVFIGVPVSFLAVGGMDTLDFSQILNPDYLAAQSSKSMEAIRATLPPE
FLSLSNITWQQVVNWAITIIPIWFVGMTLYQRIYACRDTKTARRAWYIAGLFEWPIMAFM
GVSLGILARVAAEQGMFDALGAGAVVDPETGLPMLLRSVLPVGLMGLMLSSYFSAILSTA
DSCLMASSGNIVTDVLSHFFSIDPDSPKTLRLSQLVTLLVGAFALWLATMMTNVLDLMLY
SYAFMVSGLFVPIVGALFWERRSSLAAFWAMLVGGIVTVVLQVSTLGTPGPDADILLLSD
KVQSFFPAEVKQTWLSMSEFEVRALVEHTLSANSIVHIPWLDLTFALPFNLDPNLFGLTA
SLVLYISLTLLYPDKTKKKTWQRTTASATTPIHPETTQP