Protein Info for CA264_06240 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acetylornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 8 to 160 (153 residues), 104.7 bits, E=5e-34
• PF00185: OTCace
  • amino acids 185 to 310 (126 residues), 86.3 bits, E=2.5e-28

Best Hits

Swiss-Prot: 54% identical to AOTC_BACTN: N-acetylornithine carbamoyltransferase (argF') from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K13043, N-succinyl-L-ornithine transcarbamylase [EC: 2.1.3.11] (inferred from 73% identity to psn:Pedsa_3191)

MetaCyc: 54% identical to N-succinylornithine carbamoyltransferase (Bacteroides thetaiotaomicron)
N-succinylornithine carbamoyltransferase. [EC: 2.1.3.11]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine biosynthesis II (acetyl cycle) (8/10 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• urea cycle (4/5 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.11 or 2.1.3.3

Sequence Analysis Tools

See A0A1X9YQC6 at UniProt or InterPro

Protein Sequence (316 amino acids)

>CA264_06240 acetylornithine carbamoyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKYTSVHDVADLNQLVEEAQHLKENPYKYKALGENKTLGLIFLNPSLRTRLSTQKAGQN
LGMNVIVMNLDKEGWALETQEGAIMNGSTVEHIKEAAAVMGEYCDIIGIRSFPKLQNRDE
DYNEELLQQFIKYSKKPIVSLESATRHPLQSLADLLTIRENAEAGKRPKVVLSWAPHIKP
IPQCVANSFAEWMGQADVELVITHPEGYELADEFTKNATVTTNQQEALQDADFVYVKNWS
SYTNYGQVLTDGEGWMLTNEKLQVTNNAKVMHCLPVRRNVELSDEILDGPASLVLQQANN
RTYAAQAVLKRMLEAI