Protein Info for CA264_06225 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 21 to 394 (374 residues), 342.1 bits, E=2.8e-106
• PF00206: Lyase_1
  • amino acids 27 to 299 (273 residues), 175 bits, E=1.4e-55

Best Hits

Swiss-Prot: 66% identical to ARLY_BACTN: Argininosuccinate lyase (argH) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 66% identity to chu:CHU_3088)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (8/10 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• urea cycle (4/5 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

See A0A1X9YQA2 at UniProt or InterPro

Protein Sequence (445 amino acids)

>CA264_06225 argininosuccinate lyase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKLWQKSTAVAAEIEKFTVGRDAELDLELARFDVLGSLAHTQMLQSIGLLTAEELQVLQA
ELKRIYKTVEAGEFAIEPGVEDVHSQVELELTRRVGEAGKKIHSGRSRNDQVLVDLKLYF
RHQLQEVVQEVQALFEVLQAQSEKYKHVLLPGYTHLQVAMPSSFGLWFGAYAESLVDDVQ
LLLAAYKIADKNPLGSAAGYGSSFPLNRQMTTDLLGFEAMNYNVVYAQMGRGKTERTVAT
ALAAVAATMARMSMDLCLYMSQNFSFITLPDHLTTGSSIMPHKKNPDVFELLRGKCNRLQ
ALPTDISMLLINLPSGYHREMQLLKESLFPAFQELKSCLQMMAYMAEQVQVREDILKDDK
YKYLFSVDAVNELVLQGTAFRDAYKAVGEQIEAGTFEAPAAATHTHEGSIGNLCNQEIAE
QMQQLVDSFNFERVANAYSSLTAEA