Protein Info for CA264_06155 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 12 to 288 (277 residues), 198.1 bits, see alignment E=9.1e-63 PF01545: Cation_efflux" amino acids 14 to 205 (192 residues), 147.8 bits, see alignment E=3.5e-47 PF16916: ZT_dimer" amino acids 211 to 288 (78 residues), 50.8 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 54% identity to cli:Clim_0432)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYC9 at UniProt or InterPro

Protein Sequence (328 amino acids)

>CA264_06155 cation diffusion facilitator family transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MNSLSDNIRLQLFVVLIGVLLLVGKFTAFVLTNSNAILTDALESIINVVAGAFSLYSLVL
SSRPRDENHPYGHGKIEFVAATLEGSLILVAGGAIIIKSIFNLIDPVPLERLDIGIILIA
ASGVINYVVGLMTERKGRQNNSMVLTAGGKHLQTDAYSTAGILIGLLLIYLTGLIWLDSV
VAIIFGLMIGYTGYRILRSSIAGIMDEADYELLQRIVKVLNENRRENWIDIHNLRVIKYG
STLHIDCHLTVPWYLNVLEAHDEVEAVGKVVREKIDPSIELFIHTDPCIVESCAVCTKPG
CQKRRNDFIERVEWDFDKVIADRKHGTY