Protein Info for CA264_06125 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: alkyl hydroperoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF14289: DUF4369" amino acids 32 to 123 (92 residues), 72.1 bits, see alignment E=1.4e-23 PF00578: AhpC-TSA" amino acids 234 to 354 (121 residues), 84.5 bits, see alignment E=1.8e-27 PF08534: Redoxin" amino acids 235 to 370 (136 residues), 73.8 bits, see alignment E=4e-24 PF13098: Thioredoxin_2" amino acids 257 to 360 (104 residues), 34.4 bits, see alignment E=7.3e-12 PF13905: Thioredoxin_8" amino acids 258 to 353 (96 residues), 78.8 bits, see alignment E=1e-25

Best Hits

Predicted SEED Role

"Thiol:disulfide interchange protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQA3 at UniProt or InterPro

Protein Sequence (372 amino acids)

>CA264_06125 alkyl hydroperoxide reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKLRNMLAVASAAAFLASCQGNKTATNGEDSYTIEGKLNNASEGQVYLFELAKENFVPRD
TAALGKDGTFTFEGKVEEPTFYRITMDQQSGLMLVVDEGKIQVEADAKDINGTAKIEGSE
DSRLFQQLNKLVNENRQKQMALEQQFIQAQQQGNDAEMEKLRQQYLNMQQDVKNLIAQHP
ASVVSAFGTASLIDPVNDFAFADSMATLFNQNIPNSKYTAMLNERLQPYRSTAIGQLAPD
ITLPTPSGETKSLSSLRGKYVLVDFWASWCGPCRKENPNVVKMYNKYKDKGKGFEIFGVS
LDQSEDKWLAAIKKDNLTWPHVSDLKGWESAAAQLYNVTAIPQTVLVDPEGKIIAKGLRG
EELENKLETLLK