Protein Info for CA264_06090 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details PF07291: MauE" amino acids 14 to 98 (85 residues), 31.5 bits, see alignment E=2.1e-11 PF07681: DoxX" amino acids 16 to 101 (86 residues), 68.8 bits, see alignment E=5.1e-23

Best Hits

KEGG orthology group: None (inferred from 57% identity to gem:GM21_0540)

Predicted SEED Role

"FIG00545367: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQA4 at UniProt or InterPro

Protein Sequence (153 amino acids)

>CA264_06090 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MTFKDRVLYTHDTWSLTIVRIFLGLVIFPHGAQKLLGWFGGHGPAGFMQAFEQMSGMPGW
LGWLVIILEFIGGICLVLGFWTRIWAFCYICLFVGIILTVHLPYGFFMNWNGDKAGEGFE
YHLLVIGMAWALVVGGAGRLSIDHSMASQERRF