Protein Info for CA264_06085 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 49 (18 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details PF03458: Gly_transporter" amino acids 6 to 77 (72 residues), 74.7 bits, see alignment E=2.2e-25 amino acids 94 to 166 (73 residues), 76.9 bits, see alignment E=4.4e-26

Best Hits

Swiss-Prot: 36% identical to YICG_ECOLI: UPF0126 inner membrane protein YicG (yicG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 59% identity to dfe:Dfer_5003)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ87 at UniProt or InterPro

Protein Sequence (205 amino acids)

>CA264_06085 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSIQYILELIGTVVFAMSGALAVSEKDKEQDWFGAGFTGFVTAIGGGSLRDIMLGSYPLV
WIQDVTVLYTIIAAIVCSGLFYKWMLQLRRTFLLFDTLGISIFTIVGMEKALSLGASPEI
AAIMGMFSAVMGGVIRDMLTNEVPVLFRQEIYASACLLGAGFYLGLEYLEVERNVNFIAS
VSLIIVIRLVAVRYNLSLPKFNRLR