Protein Info for CA264_06075 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NAD-dependent deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02146: SIR2
  • amino acids 10 to 178 (169 residues), 149.8 bits, E=4.2e-48

Best Hits

Swiss-Prot: 54% identical to NPD_HELPJ: NAD-dependent protein deacylase (cobB) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: K12410, NAD-dependent deacetylase [EC: 3.5.1.-] (inferred from 63% identity to mtt:Ftrac_0523)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Sequence Analysis Tools

See A0A1X9YQC4 at UniProt or InterPro

Protein Sequence (231 amino acids)

>CA264_06075 NAD-dependent deacylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKKLVVLTGAGISAESGIATFRDANGLWEGHDVMEVASPQGWARNPKVVLDFYNERRKN
AFNVQPNQGHKILAELESDFDVRIITQNVDDLHERAGSSQVIHLHGKLFESRSTLDPKLV
YHMEGWELNIGDKCEKGSQLRPNIVWFGEPVPMMEKALEETMQADIFLVVGTSLMVYPAA
GLVDVVGAGVPVFVVDPNLPSMRKGDNIHRFEEKASTGMQKVAQILRETYR