Protein Info for CA264_06050 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ATP-dependent RNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF00270: DEAD" amino acids 26 to 192 (167 residues), 169.7 bits, see alignment E=9.7e-54 PF04851: ResIII" amino acids 45 to 185 (141 residues), 30.2 bits, see alignment E=8.4e-11 PF00271: Helicase_C" amino acids 227 to 335 (109 residues), 88.3 bits, see alignment E=8.1e-29 PF03880: DbpA" amino acids 385 to 455 (71 residues), 91.4 bits, see alignment E=6.2e-30

Best Hits

KEGG orthology group: K05591, ATP-independent RNA helicase DbpA [EC: 3.6.4.13] (inferred from 42% identity to pfs:PFLU5691)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQA5 at UniProt or InterPro

Protein Sequence (458 amino acids)

>CA264_06050 ATP-dependent RNA helicase (Pontibacter actiniarum KMM 6156, DSM 19842)
MATFKDLNLSAALLQSLHDLHYTSPTPIQEQAIPLLLQGLDVAGQAETGSGKTAAFGLPL
LQRIKPELQQVQALVVVPTRELAVQVRQELKQYARHIPNLKISAFYGGHSFRMEEASLEH
PPQVLVGTPGRLTDHLSRKTLRLSNTAQVVLDEADKLLEMGFEEELDELLRALPRNRQTV
LFSATMADDVKQLIANSLKDPKFVQATATALPDRITYYGVQVQDEQKKQALAQLLQSIDA
AGTVVFVNARLTTEEIADYLQQYGFAARALHGKLDQMERDKTMTLFRNGTTSVLVATDLA
ARGLDIDVLQQIVHYELPQHEDAYLHRSGRTGRAGKSGTVYTFVNSREAQKLEQWQEVQV
DKWLNQKDMAPATSAPAVAASALTTLHISGGRKDKLSPRDIVGALIAEVGLAATDIGKIE
IQDRHSFVAVPEGAASRAVRKLNDAKIKGRRYKVSYVK