Protein Info for CA264_06045 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 228 to 258 (31 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 13 to 331 (319 residues), 219.6 bits, see alignment E=3.2e-69

Best Hits

KEGG orthology group: None (inferred from 30% identity to cpi:Cpin_6357)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ79 at UniProt or InterPro

Protein Sequence (369 amino acids)

>CA264_06045 AI-2E family transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MGKKTKELQRLTFILLFFILLVFVLVKARDFLYPISMAVLFAYLLYPVEKKLEQWGVPRI
LANFITIITAVGVFSGLLILLYMQLSSFLTDFPAMQDKALSNLDRLQRTIDQRFGDSSPQ
NKHWLRTQVVEGLELSSSFLSELLMATTNTLVKFGLMPVYVFLALYYRNKVENFIYRQLP
SYQHSKAQQEINEISNVTKHYMAGVVIVILILCVINTTGLLLIGVEYAILLGILSAFMNF
IPYFGTLIGGAIPLLYTFVIQGDPNKALAVLGFFLVVQFTENNILTPNITGGKVNINPMF
TILSIIVGGMIWGLPGMFVAVPYLGMFKIYCDHNPDLSSWSFMLGTEGTEEHALTFGKIK
DALGFGKKK