Protein Info for CA264_06030 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cell envelope biogenesis protein OmpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00691: OmpA" amino acids 171 to 272 (102 residues), 67.5 bits, see alignment E=5.4e-23

Best Hits

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 38% identity to wvi:Weevi_0764)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ73 at UniProt or InterPro

Protein Sequence (292 amino acids)

>CA264_06030 cell envelope biogenesis protein OmpA (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKQLVRASVFLLAGSMALSSCVVSKKKYDDLMARKNALEVDKAGLEEDKATLEQQKAAL
ESAKADLEQERAQLEQQKRAYEESLAKALKEGKALGENLNMSKSQIERLNADLKAREARL
AELQRVLDEKEAAVANLRNRVSNALLGFNDKDLTIDVRNGKVYVSLAEQLLFNSGSTKVD
PKGVEALRKLASVLKEQQDVNVLVEGHTDDVPIAKGTVGMQDNWDLSVLRATEITRILAN
AGVDPTRVTPSGRSKYVPLDESKTKEARQKNRRTEIILTPKLDELFQILETT