Protein Info for CA264_05955 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 7 to 199 (193 residues), 189.7 bits, see alignment E=6.2e-60 PF08659: KR" amino acids 9 to 162 (154 residues), 49.6 bits, see alignment E=6.9e-17 PF13561: adh_short_C2" amino acids 15 to 245 (231 residues), 221.9 bits, see alignment E=1.4e-69

Best Hits

Swiss-Prot: 38% identical to FABG_BACSU: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 48% identity to bov:BOV_1080)

MetaCyc: 42% identical to cyclohexanol dehydrogenase (Aromatoleum aromaticum EbN1)
1.1.1.-

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQB6 at UniProt or InterPro

Protein Sequence (248 amino acids)

>CA264_05955 SDR family oxidoreductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKRLEDKVVFITGGNSGIGKACALEAAREGANVVIADLAKAEHQGTINELQEMGADAMFV
PIDVADVESVKSAIQATVEKYGKLDVALNNAGIGGPYSGIHDMDDKVWEKIIQINLNGQF
YCVKYELQQFLKQGGGVIVNMSSLAGLVAEHGLAPYTAAKHGLLGLTKNIAVQYAEKNIR
ANAICPYYIDTPLLDAVPQDVHQLWIAGTPARRLGKSEEVAKAFIFFASDDSSYCNGTHL
AVDGGALA