Protein Info for CA264_05930 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glyoxalase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 7 to 124 (118 residues), 65.9 bits, E=4.5e-22
• PF18029: Glyoxalase_6
  • amino acids 8 to 124 (117 residues), 31.5 bits, E=2.4e-11

Best Hits

KEGG orthology group: K07032, (no description) (inferred from 57% identity to fbc:FB2170_14063)

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

• methylglyoxal degradation I (2/3 steps found)
• methylglyoxal degradation VIII (2/3 steps found)
• superpathway of methylglyoxal degradation (4/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

See A0A1X9YQ59 at UniProt or InterPro

Protein Sequence (144 amino acids)

>CA264_05930 glyoxalase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEPRLTLITLGVRNLQRAKEFYQHVFGWQPSESSNDSIVFFQLNGMQLALFPQESLADDA
GVPAEGSGFKRFSLAHNVASEQQVDELVAQLEQKGATVLKRPEKVFWGGYSSYIADPDDN
LWEIAYNPFLLPDDPSGHRQDSIH