Protein Info for CA264_05925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 742 PF08446: PAS_2" amino acids 14 to 116 (103 residues), 66.4 bits, see alignment E=7e-22 PF01590: GAF" amino acids 149 to 298 (150 residues), 41.8 bits, see alignment E=3.1e-14 PF00360: PHY" amino acids 323 to 500 (178 residues), 160 bits, see alignment E=8.2e-51 PF02518: HATPase_c" amino acids 638 to 741 (104 residues), 64.8 bits, see alignment E=1.9e-21

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ61 at UniProt or InterPro

Protein Sequence (742 amino acids)

>CA264_05925 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MQNYKNLKVDLSNCDKEPIHIIGRIQPHGFMLILDHDSLLVEQASENVAGFLGIEASSLI
GQSLEVLCSGEGYMLLEQQLRNAVKLNPQLLLMQEQVYFGFVHLSAGKLVLECEPAVPTA
EQQRLENAYQFAQFQTDLNELDTMAGQSQLVVDYVQRVLDYDRVMLYKFDEDWNGEVIAD
RVKPGVHSYLHHHFPASDIPAPARALLEKKQVRQIPDVQAQAVDIVPYLNPATGSPSNII
LSELRNPSEIHLEYLRNMDVSATLSFSIMVKGKLWGLITCQHLTPVFKDYWKRQLCYLIA
KAFSNAILSDSEQRDVQTLAQSKKLEEELIQRLSGASHIGKELFEGEVNLLHLTGCSAAA
LYFNHELIASGQGPDESQVMQIIDWLSENNTSRVFSTRQLSSHMPGAEAFRANASGLLAL
EISRYNKEYILYFKPEIKETRIWAGNPDKPLPGGDMRIHPRKSFQNWTEVIKGKSEPWTV
NELEITQMLLKDITAIILRNQASQLKQLNQELKLYTQDLHVKNSRLEDFAHIITHNLRSP
LKNIKGLHSLYLAEPTNESAAEIMEHISKMTDNISATIDDLNLILKAAIEQQLPQCNVQL
HDIIEKEIENLQAEIKQTDAKICTDLQVPALNMPKVYLESIMHNLLSNALKYRGDRPPLI
TVRSWQEEHNIYLSVADNGLGMDLGKVGPKLFGLYNTFHRKKDAKGLGLYLTRMQVEGLG
GKISVESAPEKGTTFTVQLPRH