Protein Info for CA264_05880 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF00106: adh_short" amino acids 16 to 203 (188 residues), 149.6 bits, see alignment E=1.2e-47 PF08659: KR" amino acids 17 to 130 (114 residues), 40.1 bits, see alignment E=5.8e-14 PF13561: adh_short_C2" amino acids 25 to 259 (235 residues), 160.6 bits, see alignment E=7.4e-51

Best Hits

Swiss-Prot: 49% identical to DECR_HUMAN: 2,4-dienoyl-CoA reductase, mitochondrial (DECR1) from Homo sapiens

KEGG orthology group: K13237, peroxisomal 2,4-dienoyl-CoA reductase [EC: 1.3.1.34] (inferred from 72% identity to ran:Riean_0865)

Predicted SEED Role

"2,4-dienoyl-CoA reductase, mitochondrial precursor (EC 1.3.1.34)" (EC 1.3.1.34)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ62 at UniProt or InterPro

Protein Sequence (291 amino acids)

>CA264_05880 short-chain dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIKAEPMLKEGALKDKTIIVTGGGTGLGRSMVKYFLELGANAVICSRKLDVLEQTAKELE
DETGGTVLPVACDVRKYNEIEAMLETTLKRFGRVDALVNNAAGNFVSPTERLSHKAFDVV
TDIVLKGSYNCTLALGKHWIEQKQEANILNIVTTYAWTGSGYVVPSACAKAGVLAMTRSL
ASEWAKYGIRSNAIAPGPFPTEGAWTRLFPKQLADKLDPVKRIPVGRFGEHQELANLAAY
LVSDYASFVNGEVVTIDGGEWLHGAGEFNSFDQIPQEMWDAMEKQMRGKGQ