Protein Info for CA264_05770 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cytochrome c class i

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 158 to 184 (27 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 32 to 119 (88 residues), 39.6 bits, see alignment E=8.2e-14 amino acids 307 to 381 (75 residues), 44.4 bits, see alignment E=2.6e-15 PF00034: Cytochrom_C" amino acids 33 to 121 (89 residues), 53.4 bits, see alignment E=8.5e-18 amino acids 309 to 385 (77 residues), 31.9 bits, see alignment E=4.3e-11 PF14715: FixP_N" amino acids 225 to 267 (43 residues), 64.5 bits, see alignment 8.9e-22

Best Hits

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ50 at UniProt or InterPro

Protein Sequence (400 amino acids)

>CA264_05770 cytochrome c class i (Pontibacter actiniarum KMM 6156, DSM 19842)
MSWNTVKIKKGSLALAAGLLLLGTTAVQAQDAVEGKKIFDANCSACHSIETDVVGPALKD
VHKRRDEAWIKKFVKNSTEMIQSGDPTAKEVFEKYGKVQMASFGGQLSDSDIDNVIAYVK
EESEKPAAAAATPAADSGTEAEAAAAPKEVSFMELPPLVHITIALSGIIVLLIIATLIML
IRLFIPMLGDSIYDEDFRSSFAGRVLFLMRGDATVVTGKAKDEIHSNHDFDGIQEYDNDL
PPWWKYMFYVSIVFAIGYMLHFHVFNSGLLQEQEYELEMQQAALFAASADNDPNAVTNFE
VLTDAAALESGKSTFLTNCAACHGQEAQGTVGPNLTDEYWLHGGNVNDIFKTVKFGVPAK
GMVPWQGKLSKDQILEVSSYILSLQGTNPANAKEPQGEKQ