Protein Info for CA264_05765 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cytochrome c oxidase accessory protein CcoG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 44 to 68 (25 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 41 to 466 (426 residues), 414.4 bits, see alignment E=3e-128 PF12801: Fer4_5" amino acids 93 to 129 (37 residues), 44.4 bits, see alignment 5.9e-15 PF13746: Fer4_18" amino acids 218 to 322 (105 residues), 129.9 bits, see alignment E=2.4e-41 PF13534: Fer4_17" amino acids 222 to 283 (62 residues), 24.4 bits, see alignment E=1.6e-08 PF12800: Fer4_4" amino acids 267 to 281 (15 residues), 16.1 bits, see alignment (E = 5.3e-06) amino acids 292 to 304 (13 residues), 12.3 bits, see alignment (E = 9.2e-05) PF11614: FixG_C" amino acids 354 to 468 (115 residues), 63.2 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: None (inferred from 57% identity to gfo:GFO_1436)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ20 at UniProt or InterPro

Protein Sequence (470 amino acids)

>CA264_05765 cytochrome c oxidase accessory protein CcoG (Pontibacter actiniarum KMM 6156, DSM 19842)
MPTTTKQKPTEEFRDHLSTVDAEGKRVWVYPKKPQGKLYNYRKYVSYGLLALLFAGPFIK
INGLPLLMLNIVERKFVIFGVLFWPQDFFLLVLAFLAMTLFIILFTVVYGRVFCGWVCPQ
TIFLEMVFRRIEYAIEGDYTKQKALDKMPWNAEKILKKGSKTAIFLAISFLIANTFLAYV
IGIDALREIATDNPFNHLGGLGAIVVFTGLFYGVFAWFREQVCTIACPYGRLQGVMLDKK
TVVVAYDYGRGEPRGKLRKNQERTEGDCIDCKQCVHVCPTGIDIRNGAQQLECINCTACI
DACNDIMRMIEKPEGLIRYESEEGIAEGKKWKFFTPRVIGYTAVLAVLLTALSTLLLTRD
EAQATILRTPGQLYQKTEQGHIKNLYNISVINKTNHEMPLTLKLLDKQGTIQVIGGEQLV
LPAQGIVEGVFFTEIPLEELQGMNSEIEVGLFYNDELITVQDTKFLAPAH