Protein Info for CA264_05720 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details PF01569: PAP2" amino acids 60 to 178 (119 residues), 78.4 bits, see alignment E=2.2e-26

Best Hits

Swiss-Prot: 35% identical to LPXF_BACTN: Lipid A 4'-phosphatase (lpxF) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: None (inferred from 45% identity to aas:Aasi_0568)

Predicted SEED Role

"putative membrane-associated phospholipid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ15 at UniProt or InterPro

Protein Sequence (191 amino acids)

>CA264_05720 phosphatase PAP2 family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MLEMLEQLDKEAFLYLNEMHSPFWDAVMVFVSEKLVWIPFYLGLIVYLVWRYRRKSILML
LLVIVAIGLSDFIASGIMKPYFMRLRPCHDPTLSEFINIVEGCGGRFGFISSHAANTFAL
AVFFSLILSDRYLAFKVILIAWAVVVTYSRIYLGVHFPGDVLLGALLGSFMAYLCSLAFY
ILVNKYPYFSR