Protein Info for CA264_05655 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: FAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 PF00890: FAD_binding_2" amino acids 86 to 120 (35 residues), 23.6 bits, see alignment 1e-08 PF01134: GIDA" amino acids 200 to 250 (51 residues), 22.1 bits, see alignment 2.6e-08 PF21688: FAD-depend_C" amino acids 270 to 469 (200 residues), 233 bits, see alignment E=1.3e-72

Best Hits

KEGG orthology group: K07137, (no description) (inferred from 61% identity to dfe:Dfer_2641)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenase, sll0175 homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ01 at UniProt or InterPro

Protein Sequence (526 amino acids)

>CA264_05655 FAD-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MRKKELDLVLPPELAFDAQQLDTELLKRAQVQPEDVKFLHRVKRSIDARGRSVQVRVRAD
VYLDTPPADLISPTYTYPDVSKGKPVVIVGAGPAGLFAALRCIELGLKPVVLERGKDVRS
RRRDLAAINKEHTVNPDSNYCFGEGGAGTYSDGKLYTRSKKRGDLMRILQIFVQHGATPD
ILFDAHPHIGTNKLPKIIEAIRETVRNAGGEVLFDKRVSDFIVEQGEMRGVVTQDGQAYT
GESVILATGHSARDIFELLHKREITVEAKPFAMGVRVEHQQSLIDSIQYKCEDRGPYLPA
SSYALVQQTHYKNRQRGIFSFCMCPGGFIVPSATAPGEVVVNGMSPSRRDSRFSNSGIVV
AIELEDMDLKKHGALAGLRMQQALEQRACQMAGGTQAAPAQLLQDFTRAKTGGQLLETSY
QPGLVPVDMNELFSDEMAYRMREGFKAFGNKMRGYLTNSAQIVGVESRTSSPVRIPRDRE
TLEHVQVKRLFPCGEGAGYAGGIVSAAMDGERCAEMAALKAGVRAI